Pay in 4 interest-free payments of $59.00 Learn more
Ships within 48 hours · Estimated delivery Jul 26 - Jul 31
and the protein dimer contains α And &beta 2 glycopeptide subunits
"Soluble gp130 spliceosome prevented IL-6/IL-6R trans-signaling
particularly in individuals without traditional risk factors
Expression System HEK293 Molecular Weight 47-53kDa (Reducing) Purity >95% by SDS-PAGE Endotoxin <0
Species Mouse Synonyms FL
BMPRIA/ALK-3 His Tag Protein, Mouse Drug Target Proteins and the protein dimer containsProduct Specification Species Mouse Antigen ALK 3 BMPRIA Synonyms 10q23del; ACVRLK3; ALK3 Accession Q9BXN2 Amino Acid Sequence Gln24 Arg152, with C terminal 8*His QNLDSMLHGTGMKSDLDQKKPENGVTLAPEDTLPFLKCYCSGHCPDDAINNTCITNGHCFAIIEEDDQGETTLTSGCMKYEGSDFQCKDSPKAQLRRTIECCRTNLCNQYLQPTLPPVVIGPFFDGSIRGGGSHHHHHHHH Expression System HEK293 Molecular Weight 20 28kDa (Reducing) Purity >95% by SDS PAGE Endotoxin <0. 1EU g Conjugation Unconjugated Tag His Tag
US$ 111.00
US$ 60.00
US$ 73.00
US$ 78.00
US$ 117.00
US$ 114.00
US$ 55.00
US$ 95.00
US$ 110.00
US$ 190.00
US$ 77.00
US$ 35.00
US$ 75.00
US$ 95.00
US$ 35.00
US$ 170.00